PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000121669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 161aa    MW: 18240.6 Da    PI: 5.7154
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000121669genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31101159159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDg++WrKYG+K+vk+s++pr+YY+C+ +gC vkk+ver++edp++v++tYeg Hnh+
  MDP0000121669 101 LDDGFKWRKYGKKVVKNSPHPRNYYKCSVEGCLVKKRVERDREDPRFVITTYEGVHNHP 159
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.4E-3487159IPR003657WRKY domain
SuperFamilySSF1182902.48E-2894159IPR003657WRKY domain
PROSITE profilePS5081130.9496161IPR003657WRKY domain
SMARTSM007749.6E-37101160IPR003657WRKY domain
PfamPF031066.1E-25102159IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSGGNFRSVE SPETNDFSNN SNFEFSEYLM IGEWLDEDPS SVASELSVQN SGFRANEADD  60
SGAGSSQHGL STSRXESGSS RERQETRERV AFKTKSEVEI LDDGFKWRKY GKKVVKNSPH  120
PRNYYKCSVE GCLVKKRVER DREDPRFVIT TYEGVHNHPG L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2891158774Probable WRKY transcription factor 4
2lex_A3e-2891158774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.255030.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356462.11e-116PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ55e-48WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A059CLX93e-62A0A059CLX9_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g01470.t012e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.14e-44WRKY DNA-binding protein 50